DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-8

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001379090.1 Gene:chil-8 / 174541 WormBaseID:WBGene00007473 Length:399 Species:Caenorhabditis elegans


Alignment Length:401 Identity:92/401 - (22%)
Similarity:191/401 - (47%) Gaps:56/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SALLFSLLCLCLGFIGLGLLGIQTGEV-HKVGQRLVCYYASDGTHNLSLLDVPGDLCTHINIGPA 99
            |.|:.||.|....|..    .:|:..| |:  :|::.|.:||....:::..:  :..||:.....
 Worm    22 SFLVSSLFCYFYDFSN----SVQSPSVLHR--KRIIGYVSSDEGSEITIKQL--EKLTHVIFAFI 78

  Fly   100 TL-DNATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSGRSFALMVANHAMRKLFLRSLR 163
            .: .:.||......:....:..|.....:..:.:::.|||.:|...|:.::..  .:|..:.|:.
 Worm    79 LVHKDGTIKFKYGTKDGFFDMKRKSMELNRGLKVMVSIGGYESSPLFSDVLVK--KKKKLIASIA 141

  Fly   164 EILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREK----RTNDILSLAVAAPEGIA 224
            .:::.: .|||:|:.|.:||..|:....:  .:.|:|.:....|    |:|:.: ::|.||...:
 Worm   142 LLVKKF-DLDGVDIFWNWPSITDQSNYLI--FIRELRKKLTNLKDENGRSNEYV-ISVIAPSSSS 202

  Fly   225 F--YAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATF-NINYTVQWWL 286
            .  |.|...||....|::|:::::: ||..:.  .|.::|||..|        | |::.|:::.:
 Worm   203 HSEYPYKWTEILENVDFINVITFEY-FYEANK--IGPHSPLYGGS--------FGNVDDTLKYLI 256

  Fly   287 KSGLEPQRL--VVGL-PTYGHSFTLVNPLNHR-IGAP---ASGYGKCGQLGFTTLTETCECVTKF 344
            .....|.:|  ||.. ..|..:.||  |.:.: :..|   |.|....|...|..::.      .|
 Worm   257 CRTRTPNKLNMVVSFNGIYWGNTTL--PFDDKGVWIPDDSAQGPYSYGWKQFARMSH------GF 313

  Fly   345 FKPNLSYDAESCSPYL--SALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS---- 403
            .:.:..::.|:.:||:  :..|:::::||:.|:..|.||..:.|:|||.:::::.||.:|:    
 Worm   314 DQNDFEWNEETRTPYIWKADTQQFLTFENEKSLTEKMNYAVAHNIGGVAMYTIDDDDEENTLLNV 378

  Fly   404 -CSIMPNLKYS 413
             .:.:|:||.|
 Worm   379 VVTNLPSLKKS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 76/346 (22%)
GH18_chitinase-like 69..428 CDD:299167 82/367 (22%)
chil-8NP_001379090.1 Glyco_18 49..369 CDD:214753 76/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.