DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and T19H5.6

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:244 Identity:56/244 - (22%)
Similarity:120/244 - (49%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LLCLCLGFIGLGL-------LGIQTGEVHKVGQRLVCYYASDGTHNLSLLDVPGDLCTH---INI 96
            :|.:.:..:.|||       :.::........:|::.|||......:::.:| .:| ||   ..:
 Worm    36 ILIIFMSIVTLGLVVVIRSFVFVEENAPTVCEKRVIGYYAGTEKSQITIEEV-SEL-THAVFAFV 98

  Fly    97 GPATLDNATIVLPD--------TLRQVLQNDTRSFRAAHPQVHLLLWIGGADSGRSFALMVANHA 153
            ..||  :.|::..:        .|:::.:|:..:       |.::..|||.|:.::|:.:.|:..
 Worm    99 YMAT--DGTLMFSNQAQRNRFLKLKELTKNENST-------VKMMFSIGGKDNSQNFSPVTASPD 154

  Fly   154 MRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREKRTNDILSLAVA 218
            .:|.|:.::.|:|..| .|||:||.|.:|.:.|::  ..:..|.|::.: .:.:|.:.|||: |.
 Worm   155 RKKSFINAILELLEKY-DLDGVDLFWRWPKSDDKD--EYAVFLRELKKQ-LKARRKDYILSV-VV 214

  Fly   219 APEGIAFY--AYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYA 265
            ||..|..:  .:||::|..:||::::       |......|...:|::|
 Worm   215 APLDINRWDSKFDIKKIIKHADFISI-------YGLAKNTTDSESPMFA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 52/211 (25%)
GH18_chitinase-like 69..428 CDD:299167 51/210 (24%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.