DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and CHI3L1

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001267.2 Gene:CHI3L1 / 1116 HGNCID:1932 Length:383 Species:Homo sapiens


Alignment Length:416 Identity:131/416 - (31%)
Similarity:204/416 - (49%) Gaps:75/416 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGLLGIQTGEVHKV------GQRLVCYYAS-------DGTHNLSLLDVPGDLCTHINIGPATLDN 103
            :|:...|||.|..|      ..:|||||.|       ||:.....||  ..|||||....|.:.|
Human     1 MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALD--RFLCTHIIYSFANISN 63

  Fly   104 ATIVLPDTLRQVLQNDT------RSFRAAHPQVHLLLWIGGADSG-RSFALMVANHAMRKLFLRS 161
            ..|   ||..   .||.      .:.:..:|.:..||.:||.:.| :.|:.:.:|...|:.|::|
Human    64 DHI---DTWE---WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKS 122

  Fly   162 LREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREKRTND---ILSLAVAAPEGI 223
            :...|||: ..||:||.|.:|..  |::.|.:.|:.|::.|:.:|.:...   :||.|::|.:..
Human   123 VPPFLRTH-GFDGLDLAWLYPGR--RDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVT 184

  Fly   224 AFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKS 288
            ...:|||.:|:.:.|::::|:||||.....|  ||.::||:...::.|.....|.:|.|.:.|:.
Human   185 IDSSYDIAKISQHLDFISIMTYDFHGAWRGT--TGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL 247

  Fly   289 GLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFKPNLSYDA 353
            |....:||:|:||:|.||||.:. ...:|||.||.|..|:  ||....|           |:| .
Human   248 GAPASKLVMGIPTFGRSFTLASS-ETGVGAPISGPGIPGR--FTKEAGT-----------LAY-Y 297

  Fly   354 ESCS---------------PYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS 403
            |.|.               ||.:...:|:.|::|.|:..|..|:|...|.|.||::|:.||.:.|
Human   298 EICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGS 362

  Fly   404 -CSIMPNLKYSEKPVFPLTQAIKDIL 428
             |.  .:|:      ||||.||||.|
Human   363 FCG--QDLR------FPLTNAIKDAL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 111/361 (31%)
GH18_chitinase-like 69..428 CDD:299167 124/391 (32%)
CHI3L1NP_001267.2 Glyco_18 23..357 CDD:214753 111/361 (31%)
GH18_chitolectin_chitotriosidase 24..380 CDD:119351 124/391 (32%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71 0/3 (0%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100 2/2 (100%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 204..207 1/2 (50%)
Important for AKT1 activation and IL8 production. /evidence=ECO:0000250 324..338 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.