DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and LOC100494478

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_002931718.1 Gene:LOC100494478 / 100494478 -ID:- Length:361 Species:Xenopus tropicalis


Alignment Length:283 Identity:63/283 - (22%)
Similarity:105/283 - (37%) Gaps:93/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LDGIDLDWEFPSAY-DRERMHLSQLLYEIRTEWRREKRTNDILSLAVAAPEGIAFYAYDIREINL 235
            :||.:||.|.|... ..|...|:.|:.|....:.||...:.:......||..:|...|:...|..
 Frog   121 MDGFNLDIEQPVLKGSPEYYALTALVQETTEAFHREIPGSQVTFDVPWAPNCVAARCYNYTGIAD 185

  Fly   236 YADYVNLMSYDFHFYREDTP--FT----GLNAPLYARSQERSLMATFNINYT-VQWWLKSGLEPQ 293
            ..|::.:||||.      .|  ||    |.|:|             :|...| ...::..|:.|:
 Frog   186 LCDFLFVMSYDM------PPQLFTEWVAGANSP-------------YNETLTGYDQFINLGINPK 231

  Fly   294 RLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFKPNLSYDAESCSP 358
            :||:|:|.||:.:..:.                       ||:..:|:  .||.:|...|....|
 Frog   232 KLVMGIPWYGYDYECLK-----------------------LTKDNKCI--LFKESLLDSAAQQVP 271

  Fly   359 YLSALQE---------W--------------------ISYENQTSIACKANYVKSLNLGGVMVFS 394
            |.:.:::         |                    :.|::..||:.||.||...:|.|:.:::
 Frog   272 YSTIMKQLNSSLSGRLWDDFQKSPFFNYLDTQGNIHQVWYDDPESISLKAAYVPKRSLRGIGMWN 336

  Fly   395 LNTDDLKNSCSIMPNLKYSEKPV 417
            .:|            |.||..||
 Frog   337 ADT------------LDYSSDPV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 57/262 (22%)
GH18_chitinase-like 69..428 CDD:299167 63/283 (22%)
LOC100494478XP_002931718.1 GH18_chitobiase 10..359 CDD:119354 63/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.