DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chia.5

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001103511.2 Gene:chia.5 / 100003900 ZFINID:ZDB-GENE-071004-113 Length:481 Species:Danio rerio


Alignment Length:385 Identity:105/385 - (27%)
Similarity:187/385 - (48%) Gaps:33/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VGQRLVCYYASDGTHNLSL-----LDVPGDLCTHINIGPATLDNAT-IVLPDTLRQVLQNDTRSF 123
            :..:|:||:.:...:...:     .:|...||||:....:.::|.. :...:...:.|.......
Zfish    19 LASQLICYFTNWSQYRPDVGKYMPSNVDPHLCTHLIYAFSIINNENKLTTYEWNDETLYQSFNGL 83

  Fly   124 RAAHPQVHLLLWIGGADSGRS-FALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSA--- 184
            :.::..:..||.:||.:.|.: |:.||:....|:.|::|....|||: ..||:|||||:|.:   
Zfish    84 KQSNSNLKTLLAVGGWEFGSAQFSSMVSMPQNRQTFIQSSITFLRTH-GFDGLDLDWEYPGSRGS 147

  Fly   185 --YDRERMHL--SQLLYEIRTEWRREKRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSY 245
              .|::|..|  .:|:...:.|.....|...:|:.||||.:||....|:|.||..|.|::|:|:|
Zfish   148 PPEDKQRFTLLCKELVEAYQAESAATGRPRLMLTAAVAAVKGIIDAGYEIAEIAKYLDFINIMTY 212

  Fly   246 DFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVN 310
            |||..:::  .||.|:|||..|.:......:|.::.:.:|...|...::|.:|...||.:|.| :
Zfish   213 DFHGSQDN--ITGHNSPLYRDSGDTGDQIYYNTDFAMNYWRDQGAPVEKLRMGFAAYGRTFRL-S 274

  Fly   311 PLNHRIGAPASGYGKCG----QLGFTTLTETCECVTKFFKPNLSYDAESCSPYLSALQEWISYEN 371
            ..::.:||||||....|    :.||.:..|.|..:.......:   .:...||.:..|||:.:::
Zfish   275 SADNGVGAPASGAALAGTYTREAGFWSYYEICTFLQGAIVQQI---VDQKVPYATKGQEWVGFDD 336

  Fly   372 QTSIACKANYVKSLNLGGVMVFSLNTDDLKNSCSIMPNLKYSEKPVFPLTQAIKDILRES 431
            |.|...|.:|:|....||..|:||:.||...        ::..:..:||...:..:|..|
Zfish   337 QESYETKVDYLKEKGFGGAFVWSLDLDDFSG--------QFCGQGKYPLIGHLHTLLNIS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 99/347 (29%)
GH18_chitinase-like 69..428 CDD:299167 103/376 (27%)
chia.5NP_001103511.2 Glyco_18 22..363 CDD:214753 99/347 (29%)
GH18_chitolectin_chitotriosidase 23..381 CDD:119351 103/372 (28%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.