DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G72200

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_177365.1 Gene:AT1G72200 / 843552 AraportID:AT1G72200 Length:404 Species:Arabidopsis thaliana


Alignment Length:41 Identity:15/41 - (36%)
Similarity:24/41 - (58%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            ||.:||.:....:|:..:| |..::|.||||.|...:.:||
plant   143 ECSVCLNEFEDDETLRLIPKCCHVFHPGCIDAWLRSHTTCP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 15/41 (37%)
AT1G72200NP_177365.1 HRD1 <129..288 CDD:227568 15/41 (37%)
RING-H2_EL5-like 143..186 CDD:438124 15/41 (37%)

Return to query results.
Submit another query.