DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and DEP

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_177247.1 Gene:DEP / 843430 AraportID:AT1G70910 Length:161 Species:Arabidopsis thaliana


Alignment Length:41 Identity:14/41 - (34%)
Similarity:22/41 - (53%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CVIC-LEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            |.:| ||:....|    :| |..::|..|||:|...:.:||
plant   114 CGLCLLEEQHLFD----MPNCAHVFHGDCIDKWLSTSNNCP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 14/41 (34%)
DEPNP_177247.1 RING_Ubox 114..152 CDD:473075 14/41 (34%)

Return to query results.
Submit another query.