DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G60360

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_176239.1 Gene:AT1G60360 / 842331 AraportID:AT1G60360 Length:327 Species:Arabidopsis thaliana


Alignment Length:55 Identity:20/55 - (36%)
Similarity:28/55 - (50%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 PRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            |.:......|::...:|.:|:|:...|.....|||..||||.||..|..:|.|||
plant   208 PSVKITPQHLTNDMSQCTVCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 19/51 (37%)
AT1G60360NP_176239.1 zinc_ribbon_9 24..56 CDD:433910
RAD18 199..>325 CDD:227719 20/55 (36%)
RING_Ubox 223..265 CDD:473075 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.