DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G57730

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_176085.1 Gene:AT1G57730 / 842148 AraportID:AT1G57730 Length:174 Species:Arabidopsis thaliana


Alignment Length:96 Identity:25/96 - (26%)
Similarity:41/96 - (42%) Gaps:21/96 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SFNGIKCPVCNKFVL-------PDDIECHLVMCLTKPRLSYNEDVLSDAKGE---CVICLEDLSP 269
            |.:|.:  :|.:..|       |.|:..|:.       :.:.|:..|.:..|   |.|||||:|.
plant    70 SISGTR--LCVEMALASERVPAPFDMYLHVT-------VRFVEESTSSSPLENKTCAICLEDMSQ 125

  Fly   270 G-DTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            . .....:| |..::|..||.:|...:..||
plant   126 DVHDYQEMPNCPHVFHNDCIYKWLGHSNLCP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 18/56 (32%)
AT1G57730NP_176085.1 RING_Ubox 116..159 CDD:473075 15/41 (37%)

Return to query results.
Submit another query.