DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G49230

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_175349.1 Gene:AT1G49230 / 841346 AraportID:AT1G49230 Length:219 Species:Arabidopsis thaliana


Alignment Length:55 Identity:19/55 - (34%)
Similarity:29/55 - (52%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LSYNEDV-LSDAKGECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            :||:.:: |.....||.|||.:....:.:..|| |...:|..|||:|...:.|||
plant   116 VSYSTELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 18/53 (34%)
AT1G49230NP_175349.1 RING-H2_EL5-like 130..173 CDD:438124 16/41 (39%)

Return to query results.
Submit another query.