DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G35330

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_174766.2 Gene:AT1G35330 / 840422 AraportID:AT1G35330 Length:328 Species:Arabidopsis thaliana


Alignment Length:110 Identity:31/110 - (28%)
Similarity:44/110 - (40%) Gaps:28/110 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 FNGIKCPVCNKFV------LPDDIE--CHLVMCLTKPRLS--YNEDVL--------SDAKG---- 258
            |:.:.|.||.|:.      ...|.|  .|..:..|: |.|  ..:||:        |..||    
plant    60 FSMLACCVCYKYTNTSPHGTSSDTEEGGHGEVAFTR-RTSRGLGKDVINSFPSFLYSQVKGLKIG 123

  Fly   259 ----ECVICLEDLSPGDTIARL-PCLCIYHKGCIDRWFEVNRSCP 298
                ||.|||.:....:|:..: ||...:|..|||.|.....:||
plant   124 KGGVECAICLNEFEDEETLRLMPPCSHAFHASCIDVWLSSRSTCP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 20/68 (29%)
AT1G35330NP_174766.2 RING-H2_EL5-like 128..171 CDD:438124 15/41 (37%)

Return to query results.
Submit another query.