DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT1G18770

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_173312.1 Gene:AT1G18770 / 838459 AraportID:AT1G18770 Length:106 Species:Arabidopsis thaliana


Alignment Length:46 Identity:20/46 - (43%)
Similarity:28/46 - (60%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SDAKGE-CVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            :.:.|| |:||||:.|.|..:..|||...:...|:.:|||.|.|||
plant    52 TSSTGEMCIICLEEFSEGRRVVTLPCGHDFDDECVLKWFETNHSCP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 20/46 (43%)
AT1G18770NP_173312.1 RING-H2_PA-TM-RING 59..100 CDD:438118 18/39 (46%)

Return to query results.
Submit another query.