DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and CNI1

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_198094.1 Gene:CNI1 / 832801 AraportID:AT5G27420 Length:368 Species:Arabidopsis thaliana


Alignment Length:127 Identity:28/127 - (22%)
Similarity:38/127 - (29%) Gaps:40/127 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KGDF-EPVQCDSKKNQCYCVDTNTGREIQGTRKPLSNTTKMNCMQIDFSIDSSAFPAFEKPDP-- 174
            |.|| |..:|.:||:........||.|.:...:.|..|..    |...|..||     .||.|  
plant    15 KSDFWENGECSNKKDLNASNKNITGEEARSFYESLLETED----QQSHSKKSS-----RKPKPAI 70

  Fly   175 -------AKPKNDQPIGKPWCASNRNAGH---------------------TCNQNKTSIRYW 208
                   |..:::|..........::.||                     .||.|.....||
plant    71 LSVQHRVADTQSEQNTTTAQDPKEQHKGHQLLRCSQEGDLKGLKRLVDKEKCNINFHDSYYW 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356
CNI1NP_198094.1 RING-H2_EL5-like 123..166 CDD:438124 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.