DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and RHA1B

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_192875.1 Gene:RHA1B / 826738 AraportID:AT4G11360 Length:157 Species:Arabidopsis thaliana


Alignment Length:129 Identity:35/129 - (27%)
Similarity:50/129 - (38%) Gaps:46/129 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SIRDMSMTGGSIAESIALAASATSANGIGRVYTATSLPSHIWSFNGIKCPVCNKFVLPDDIECHL 237
            |..|.:.|..|....:||:.|||.||.:                    .||.             
plant    41 SFLDHNETSRSDPTRLALSTSATLANEL--------------------IPVV------------- 72

  Fly   238 VMCLTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWF-EVNR-SCP 298
                   |.|   |:|:|.:..|.:||.|....|.|.:|| |..::|..|:|||. :.|: :||
plant    73 -------RFS---DLLTDPEDCCTVCLSDFVSDDKIRQLPKCGHVFHHRCLDRWIVDCNKITCP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 20/54 (37%)
RHA1BNP_192875.1 RING-H2_RHA1-like 82..132 CDD:438483 17/45 (38%)

Return to query results.
Submit another query.