DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT4G09560

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_192694.2 Gene:AT4G09560 / 826540 AraportID:AT4G09560 Length:448 Species:Arabidopsis thaliana


Alignment Length:40 Identity:17/40 - (42%)
Similarity:22/40 - (55%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRS-CP 298
            |.||||:...||.:..|||...:|..|:|.|....:| ||
plant   234 CCICLENYEKGDKLRILPCHHKFHVACVDLWLGQRKSFCP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 17/40 (43%)
AT4G09560NP_192694.2 PA_C_RZF_like 19..163 CDD:239038
RING_Ubox 234..279 CDD:473075 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.