DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT4G09130

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_192652.1 Gene:AT4G09130 / 826491 AraportID:AT4G09130 Length:357 Species:Arabidopsis thaliana


Alignment Length:74 Identity:19/74 - (25%)
Similarity:31/74 - (41%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 TKPRLSYNEDVL--------SDAKG--------ECVICLEDLSPGDTIARL-PCLCIYHKGCIDR 289
            ::.|...::||:        |:.|.        ||.|||.:....:.:..: ||...:|..|||.
plant    86 SRVRRGIDKDVIESFPAFLYSEVKAFKIGNGGVECAICLCEFEDEEPLRWMPPCSHTFHANCIDE 150

  Fly   290 WFEVNRSCP 298
            |.....:||
plant   151 WLSSRSTCP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 18/68 (26%)
AT4G09130NP_192652.1 HRD1 <105..218 CDD:227568 16/55 (29%)
RING-H2_EL5-like 119..162 CDD:438124 14/41 (34%)

Return to query results.
Submit another query.