DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT3G56580

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_567039.1 Gene:AT3G56580 / 824825 AraportID:AT3G56580 Length:320 Species:Arabidopsis thaliana


Alignment Length:188 Identity:43/188 - (22%)
Similarity:60/188 - (31%) Gaps:73/188 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GNANANSNSNFT-------------AAGNN-------NGSAMQSYMQQRRTLGDSIRDMSMTGGS 183
            |:|.:.|.||..             |.|:|       ||:|....:.:....||     ...|..
plant    82 GSAGSESFSNLAPLLIFGGQAPFRLAGGDNSSVEAFVNGAAPGIGIARGTNAGD-----YFFGPG 141

  Fly   184 IAESIALAASATSANG--------IGRVYTATSLPSHIWSFNGIKCPVCNKFVLPDDIECHLVMC 240
            :.|.|...:|.|...|        |..:.|......|:.|.:. .||||.     |:.|      
plant   142 LEELIEQLSSGTHHRGPPPAPKSSIDALPTIKITQKHLKSSDS-HCPVCK-----DEFE------ 194

  Fly   241 LTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
                       :.|:||                 ::||..|||..||..|...:.|||
plant   195 -----------LKSEAK-----------------QMPCHHIYHSDCIVPWLVQHNSCP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 14/51 (27%)
AT3G56580NP_567039.1 zinc_ribbon_9 6..37 CDD:433910
RING-H2_RNF126-like 186..227 CDD:438329 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.