DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT3G19950

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001326918.1 Gene:AT3G19950 / 821533 AraportID:AT3G19950 Length:386 Species:Arabidopsis thaliana


Alignment Length:64 Identity:18/64 - (28%)
Similarity:35/64 - (54%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 PRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP----EHPGD 303
            |.:...:|:|.....:|.:|:::...|..:.::||..::|:.|:..|.|::.|||    |.|.|
plant   258 PTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 16/58 (28%)
AT3G19950NP_001326918.1 zinc_ribbon_9 78..111 CDD:433910
RING-H2_RNF126-like 273..315 CDD:438329 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.