DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT3G15740

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_188195.1 Gene:AT3G15740 / 820817 AraportID:AT3G15740 Length:224 Species:Arabidopsis thaliana


Alignment Length:132 Identity:28/132 - (21%)
Similarity:54/132 - (40%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 TLGDSIRDMSMTGGSIAESIALAASATSANGIGRVYTATSLPSHIWSFNGIKCPVCNKFVLPDDI 233
            ||.|.|:|:...|....|.:.:....|.:...|.       ..|:    .::..:.......:.:
plant   108 TLADEIKDLKKDGAKDVERVQVKIGVTVSRFPGE-------DDHV----DVQVQLAVAPANDEAV 161

  Fly   234 ECHLVMCLTKPRLSYNEDVLSDAKGECVICLEDLSPGDTI--ARLPCLCIYHKGCIDRWFEVNRS 296
            |.||            |.::.:.:|.||||::::..|..:  .|:||..::|:.|.:.|...:..
plant   162 EMHL------------ETLVVENEGYCVICMDNIRVGSDVEAGRMPCSHVFHRTCGEEWLRNSGI 214

  Fly   297 CP 298
            ||
plant   215 CP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367 12/41 (29%)
AT3G15740NP_188195.1 zf-RING_2 176..219 CDD:290367 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.