DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and ATL6

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_566249.1 Gene:ATL6 / 819684 AraportID:AT3G05200 Length:398 Species:Arabidopsis thaliana


Alignment Length:62 Identity:23/62 - (37%)
Similarity:32/62 - (51%) Gaps:6/62 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 TKPRLSYNEDVLSDAKG----ECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            |.|...|: ||.:...|    ||.|||.:....:|:..|| |..::|..|||.|.|.:.:||
plant   107 TFPTFLYS-DVKTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWLEAHVTCP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 21/56 (38%)
ATL6NP_566249.1 HRD1 <113..>219 CDD:227568 21/56 (38%)
RING-H2_EL5-like 127..170 CDD:438124 17/41 (41%)

Return to query results.
Submit another query.