DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14435 and AT2G46495

DIOPT Version :9

Sequence 1:	NP_001162682.2	Gene:	CG14435 / 31628	FlyBaseID:	FBgn0029911	Length:	303	Species:	Drosophila melanogaster
Sequence 2:	NP_850456.2	Gene:	AT2G46495 / 819259	AraportID:	AT2G46495	Length:	372	Species:	Arabidopsis thaliana

Alignment Length:	51	Identity:	17/51 - (33%)
Similarity:	29/51 - (56%)	Gaps:	7/51 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   249 NEDVLSDAKGECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            |:|::      |.|||.:.:..:|:..:| |...:|..|||.|.:::.|||
plant   315 NDDIV------CPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCP 359

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14435	NP_001162682.2	zf-RING_2	258..298	CDD:290367	13/40 (33%)
AT2G46495	NP_850456.2	GUB_WAK_bind	28..93	CDD:404778
		COG5219	<200..364	CDD:227544	17/51 (33%)
		RING-H2_EL5_like	319..362	CDD:319375	15/47 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000