DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT2G20030

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_179593.1 Gene:AT2G20030 / 816522 AraportID:AT2G20030 Length:390 Species:Arabidopsis thaliana


Alignment Length:41 Identity:16/41 - (39%)
Similarity:23/41 - (56%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ECVICLEDLSPGDTIARLP-CLCIYHKGCIDRWFEVNRSCP 298
            ||.:||......:.:..|| |...:|.||||:|.|.:.:||
plant   123 ECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQHATCP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 16/41 (39%)
AT2G20030NP_179593.1 RAD18 114..>202 CDD:227719 16/41 (39%)
RING-H2_EL5-like 123..166 CDD:438124 16/41 (39%)

Return to query results.
Submit another query.