Sequence 1: | NP_001162682.2 | Gene: | CG14435 / 31628 | FlyBaseID: | FBgn0029911 | Length: | 303 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_565376.1 | Gene: | AT2G15580 / 816051 | AraportID: | AT2G15580 | Length: | 196 | Species: | Arabidopsis thaliana |
Alignment Length: | 40 | Identity: | 15/40 - (37%) |
---|---|---|---|
Similarity: | 22/40 - (55%) | Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 ECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14435 | NP_001162682.2 | zf-RING_2 | 258..298 | CDD:290367 | 13/38 (34%) |
AT2G15580 | NP_565376.1 | zf-RING_2 | 149..191 | CDD:290367 | 15/40 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 47 | 1.000 | Inparanoid score | I2661 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |