DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and AT2G15580

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_565376.1 Gene:AT2G15580 / 816051 AraportID:AT2G15580 Length:196 Species:Arabidopsis thaliana


Alignment Length:40 Identity:15/40 - (37%)
Similarity:22/40 - (55%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            :|.|||:....|:|:..|||...:|..|:..|.:.|..||
plant   149 DCAICLDRFKKGETLVHLPCAHKFHSICLLPWLDTNVYCP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367 13/38 (34%)
AT2G15580NP_565376.1 zf-RING_2 149..191 CDD:290367 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2661
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.