DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and RNF128

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens


Alignment Length:39 Identity:16/39 - (41%)
Similarity:23/39 - (58%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            |.:|:|...|.|.:..|.|..|:||.|:|.|...:|:||
Human   277 CAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 16/39 (41%)
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037
RING-H2_RNF128-like 275..323 CDD:438454 16/39 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.