DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and znrf2b

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001070196.1 Gene:znrf2b / 767761 ZFINID:ZDB-GENE-060929-24 Length:217 Species:Danio rerio


Alignment Length:216 Identity:102/216 - (47%)
Similarity:124/216 - (57%) Gaps:32/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SSP--HSHPHAAHGHPAVGVTVSVSGNA-------NANSNSNFTAAGNNNGS---AMQSYMQQRR 168
            |||  :....|..|......|.||:|..       |:...|..|:|.:.:.|   |.|....:.|
Zfish     6 SSPAANGRTRAYSGSDLPSATASVNGRTAAVLRYNNSQGASGATSAASASSSAAVASQFISSRTR 70

  Fly   169 TLGDSIRDMSMTGGSIAESIALAASATSAN--------------GIGRVYTATSLPSHI--WSFN 217
            ::|.|.|..|  |.:|..|.|. :||.|.|              |..|:... |||:|:  ..|.
Zfish    71 SVGPSARPQS--GINIPNSGAY-SSADSGNSTPEEPGGERERSTGAPRLVIG-SLPAHLSPHLFG 131

  Fly   218 GIKCPVCNKFVLPDDIECHLVMCLTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIY 282
            |.|||||:||:..|:::.||||||||||::|||||||...|||.||||:|..|||||||||||||
Zfish   132 GFKCPVCSKFISSDEMDLHLVMCLTKPRVTYNEDVLSKDAGECAICLEELLQGDTIARLPCLCIY 196

  Fly   283 HKGCIDRWFEVNRSCPEHPGD 303
            ||||||.||||||||||||.|
Zfish   197 HKGCIDEWFEVNRSCPEHPAD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367 34/39 (87%)
znrf2bNP_001070196.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..111 14/50 (28%)
zf-RING_2 172..212 CDD:290367 34/39 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586864
Domainoid 1 1.000 85 1.000 Domainoid score I8122
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4147
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256682at2759
OrthoFinder 1 1.000 - - FOG0001965
OrthoInspector 1 1.000 - - otm25539
orthoMCL 1 0.900 - - OOG6_105431
Panther 1 1.100 - - LDO PTHR46661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4296
SonicParanoid 1 1.000 - - X146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.