DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and Rnf126

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_653111.1 Gene:Rnf126 / 70294 MGIID:1917544 Length:313 Species:Mus musculus


Alignment Length:205 Identity:46/205 - (22%)
Similarity:74/205 - (36%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GSITSSGSSPHSHPHAAH--------GHPAVGVTVSVSGNANANSNSNFTAAGNNNG-SAMQSYM 164
            |:....|..|.|.....|        ..|...:|..             .|.|.:.| ..::..:
Mouse    99 GAQADDGRDPESRREREHQSRHRYGARQPRARLTAR-------------RATGRHEGVPTLEGII 150

  Fly   165 QQRRTLGDSIRDMSMTGGSIAESIALAASATSANGIGRVYTATSLP-SHIWSFNG---IKCPVCN 225
            ||            :..|.|      :.:|..:.|:|......|.| .:.|..||   |...:.|
Mouse   151 QQ------------LVNGII------SPAAVPSLGLGPWGVLHSNPMDYAWGANGLDTIITQLLN 197

  Fly   226 KF--VLPDDIECHLVMCLTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCID 288
            :|  ..|...:...:..|  |.:...|:.:.... ||.:|.||.:.|:::.:|||..::|..||.
Mouse   198 QFENTGPPPADKEKIQAL--PTVPVTEEHVGSGL-ECPVCKEDYALGESVRQLPCNHLFHDSCIV 259

  Fly   289 RWFEVNRSCP 298
            .|.|.:.|||
Mouse   260 PWLEQHDSCP 269

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 18/51 (35%)