DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and Zfyve21

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001361650.1 Gene:Zfyve21 / 68520 MGIID:1915770 Length:253 Species:Mus musculus


Alignment Length:43 Identity:11/43 - (25%)
Similarity:21/43 - (48%) Gaps:6/43 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TTGQGFNLLRTLPG------LQVYHNQNSTSIDRQRARSLSSV 95
            |...|..|..|:||      |::...::::...||.|..|:::
Mouse   198 TRATGMLLQYTVPGAEAAAQLRLMAGEDASGSKRQAAAWLAAM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367
Zfyve21NP_001361650.1 FYVE_ZF21 38..101 CDD:277266
ZFYVE21_C 108..248 CDD:374733 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.