powered by:
Protein Alignment CG14435 and Zfyve21
DIOPT Version :9
Sequence 1: | NP_001162682.2 |
Gene: | CG14435 / 31628 |
FlyBaseID: | FBgn0029911 |
Length: | 303 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361650.1 |
Gene: | Zfyve21 / 68520 |
MGIID: | 1915770 |
Length: | 253 |
Species: | Mus musculus |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 21/43 - (48%) |
Gaps: | 6/43 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 TTGQGFNLLRTLPG------LQVYHNQNSTSIDRQRARSLSSV 95
|...|..|..|:|| |::...::::...||.|..|:::
Mouse 198 TRATGMLLQYTVPGAEAAAQLRLMAGEDASGSKRQAAAWLAAM 240
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1256682at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.