DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and CG32850

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster


Alignment Length:40 Identity:17/40 - (42%)
Similarity:24/40 - (60%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            |||||:.:....:.:..|||:.|||..|||.|...:.:||
  Fly    91 ECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367 15/38 (39%)
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.