Sequence 1: | NP_001162682.2 | Gene: | CG14435 / 31628 | FlyBaseID: | FBgn0029911 | Length: | 303 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726563.1 | Gene: | CG32850 / 318246 | FlyBaseID: | FBgn0052850 | Length: | 147 | Species: | Drosophila melanogaster |
Alignment Length: | 40 | Identity: | 17/40 - (42%) |
---|---|---|---|
Similarity: | 24/40 - (60%) | Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 ECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14435 | NP_001162682.2 | zf-RING_2 | 258..298 | CDD:290367 | 15/38 (39%) |
CG32850 | NP_726563.1 | zf-RING_2 | 91..132 | CDD:290367 | 17/40 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467893 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |