DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and RNF133

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_631914.1 Gene:RNF133 / 168433 HGNCID:21154 Length:376 Species:Homo sapiens


Alignment Length:39 Identity:17/39 - (43%)
Similarity:21/39 - (53%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298
            ||||.|...|.|.:..|.|...:||.|||.|...:.:||
Human   256 CVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 17/39 (44%)
RNF133NP_631914.1 PA_GRAIL_like 43..177 CDD:239037
RING-H2_RNF128-like 254..302 CDD:438454 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.