DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and TRAIP

DIOPT Version :10

Sequence 1:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_005870.2 Gene:TRAIP / 10293 HGNCID:30764 Length:469 Species:Homo sapiens


Alignment Length:42 Identity:13/42 - (30%)
Similarity:22/42 - (52%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEV--NRSCPE 299
            |.||.:.......:|.:.|...:|..|:.:|||.  :|:||:
Human     7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQ 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 13/42 (31%)
TRAIPNP_005870.2 RING-H2_TRAIP 6..50 CDD:438143 13/42 (31%)
EnvC 65..>278 CDD:443969
Interaction with CYLD. /evidence=ECO:0000269|PubMed:14676304 211..469
PIP-box. /evidence=ECO:0000269|PubMed:26711499 460..469
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.