DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14435 and znrf2

DIOPT Version :9

Sequence 1:NP_001162682.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_002937897.1 Gene:znrf2 / 100487680 XenbaseID:XB-GENE-961583 Length:224 Species:Xenopus tropicalis


Alignment Length:319 Identity:110/319 - (34%)
Similarity:140/319 - (43%) Gaps:114/319 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GQKASTPATSGQQSPRSRTFSSSS-------------TGAADSALQQ-QQHQHSNPGQNRGGNGG 52
            |:::|:||..|    |:|.:|.|.             :|.|.|:... .::.:.:.||...|:.|
 Frog     3 GRQSSSPAADG----RTRAYSGSDIPTNTARGPYRGPSGVASSSSSPIARYSYVSSGQAAAGSAG 63

  Fly    53 -GGGGNDTTGQGFNLLRTLPGLQVYHNQNSTSIDRQRARSLSSVPDIQQQAQQQQQQGSITSSGS 116
             |..|.::|                  |.:....|.|     ||..|:.||              
 Frog    64 RGASGTEST------------------QPAALASRSR-----SVGGIRSQA-------------- 91

  Fly   117 SPHSHPHAAHGHPAVGVTVSVSGNANANSNSNFTAAGNNNGSAMQSYMQQRRTLGDSIRDMSMTG 181
             |.|.|.||..          ||::.....|...|.|......|                     
 Frog    92 -PLSIPGAARD----------SGSSTPEEGSRERAPGGRESRLM--------------------- 124

  Fly   182 GSIAESIALAASATSANGIGRVYTATSLPSHI--WSFNGIKCPVCNKFVLPDDIECHLVMCLTKP 244
                              ||      |||:|:  ..|.|.|||||:||:..|:::.|||||||||
 Frog   125 ------------------IG------SLPAHLSPHLFGGYKCPVCSKFIPTDEMDLHLVMCLTKP 165

  Fly   245 RLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCPEHPGD 303
            |::||||||:...|||.||||:|..|||||||||||||||||||.||||||||||||.|
 Frog   166 RITYNEDVLTKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14435NP_001162682.2 zf-RING_2 258..298 CDD:290367 34/39 (87%)
znrf2XP_002937897.1 mRING-CH-C4HC2H_ZNRF1 179..224 CDD:319608 39/44 (89%)
modified RING-CH finger (C4HC2H-type) 181..221 CDD:319608 34/39 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8013
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4033
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256682at2759
OrthoFinder 1 1.000 - - FOG0001965
OrthoInspector 1 1.000 - - otm47519
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.