DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and TAAR8

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens


Alignment Length:342 Identity:91/342 - (26%)
Similarity:149/342 - (43%) Gaps:62/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VVPFLWQHQNAT--ETPTE-----ITLQATSFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCR 79
            ||...::..|.:  |||..     |...|.|||:             :|.:.||:|.:.:|...:
Human     9 VVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGS-------------LLAVFGNLLVMTSVLHFK 60

  Fly    80 HLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FYMGSDIGAMRGPCLLRFFLLICACCVS 137
            .|.|. :|..|.|||.:||.||: .:.:.:|      :|.|:....:...|.:.|      |..|
Human    61 QLHSP-TNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAF------CYSS 118

  Fly   138 MLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCL-----GALVALLPVFWNRWPDAQAC 197
            :|.|..|.:||||.|...|.|....|..|:...|..:|.|     ||      ||:....|....
Human   119 VLHLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGA------VFYTGVNDDGLE 177

  Fly   198 EFDEVLAPGYIAG---VITPGFVII--------WICMFLVYWRIMREASKQALRLR--QSVVYNT 249
            |.  |.|...:.|   :::.|:|:|        .:.|.::|.:|...|.:||:::.  .|.|.::
Human   178 EL--VSALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS 240

  Fly   250 DEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANS 314
            .|:..:|  :...:.|:.:.:...:..|.:.||||....:...|....:.:.||:.....|..||
Human   241 SESYKIR--VAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAYYNS 303

  Fly   315 ALNPIIYSWKNSGFRRA 331
            |:||:||:.....||:|
Human   304 AMNPLIYALFYPWFRKA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 80/296 (27%)
7tm_1 67..321 CDD:278431 74/278 (27%)
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 74/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.