DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar12h

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076378.1 Gene:taar12h / 795068 ZFINID:ZDB-GENE-041014-54 Length:344 Species:Danio rerio


Alignment Length:329 Identity:78/329 - (23%)
Similarity:135/329 - (41%) Gaps:70/329 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LWLAINAFLFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV--- 109
            |.:|:.|.:.::||.   ||:|.|:::...:.|:|. ::|.:.|||..|..:| |.:||.:|   
Zfish    33 LKVAMYAVMVLMILTTVFGNLLVIISISHFKQLQSP-THLIVQSLAACDCLLGSLVMPYSMVRSV 96

  Fly   110 ---FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSII 171
               :|:|:.:      |.:...|.:.....|:|.|..||:||:.|:...|.|:..:|.......|
Zfish    97 EGCWYLGTVV------CKVHSSLDMTFSISSILHLSLIAIDRFWAISDPLRYKMRVTNTTVAGFI 155

  Fly   172 IFNW----------------------------CLGALVALLPVFWNR-WPDAQACEFDEVLAPGY 207
            .|.|                            |.|..|    :|:|: |  ...|.....|.||.
Zfish   156 TFTWLFSFVYSFSVVFTGVNNVGLEELILQISCFGGCV----LFFNKEW--GLICALFVFLIPGT 214

  Fly   208 IAGVITPGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVF 272
            |..       .:::.:|.|   :.|.|...:.::..:....:...|:.     |.:.|:.:.:..
Zfish   215 IMS-------SLYMSIFNV---VKRHAKVMSEKVSAAATAGSHFQTSS-----HRERKAAKTLAI 264

  Fly   273 IMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAF---VQ 334
            :||.|.|||||:|.......|....:...::.........||..||:||.:....|::||   :.
Zfish   265 VMGVFYLCWLPFFTATAVDPFLNFSTPGDVFDALVWFGYFNSTCNPLIYGFFYPRFQKAFKILIS 329

  Fly   335 TLCC 338
            |..|
Zfish   330 TYIC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 71/309 (23%)
7tm_1 67..321 CDD:278431 66/289 (23%)
taar12hNP_001076378.1 7tm_4 49..325 CDD:304433 70/303 (23%)
7tm_1 51..313 CDD:278431 66/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.