DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar11

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076546.1 Gene:taar11 / 794647 ZFINID:ZDB-GENE-041014-52 Length:327 Species:Danio rerio


Alignment Length:297 Identity:80/297 - (26%)
Similarity:134/297 - (45%) Gaps:38/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV---- 109
            :||::    ...:||:.||:..|..:...:.|.:. :|..|||:||||..:| ..:|..::    
Zfish    38 YLLFI----IAIILIVFGNLWVICTISFFQQLHTP-TNYLILSMAVSDLLLGSFVMPPSMLRSLE 97

  Fly   110 --FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIII 172
              :|.|...      |..........|..|:|.|:.|::|||.||....||:..||.||:..:|:
Zfish    98 TCWYFGDFF------CKFHSATDFTLCNASVLHLVFISIDRYYAVCQPFHYQSRMTTRVSVFMIL 156

  Fly   173 FNWC------LGALVALLPVFWNRWPDAQ-ACEFDEVLAPGYIAGVITPGFVIIWICMFLV---Y 227
            .:|.      .|.:.:.|.:...|..:.. ||:...:...|...|| |...|..::.||::   |
Zfish   157 ISWSFSAFFGFGIIFSELKIEKKRTEELHVACKGGCLALHGREIGV-TYSLVFYFLPMFIIVSLY 220

  Fly   228 WRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQL 292
            .|:...|.|. :|:..|.. ::..||.|       |.|:.:.:..|:|.|..||.|||...|...
Zfish   221 SRVFIIALKH-VRVINSAA-SSLSATKM-------DLKATKTLAIIIGVFMSCWTPYFMCNIIDP 276

  Fly   293 FSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFR 329
            .......:::|:....:|..|:..||::|::..|.||
Zfish   277 IVNHTIPALLYEVLMWVAYLNAVFNPLVYAFFYSWFR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 78/286 (27%)
7tm_1 67..321 CDD:278431 72/270 (27%)
taar11NP_001076546.1 7tmA_TAAR1 49..313 CDD:320438 74/280 (26%)
TM helix 2 69..95 CDD:320438 10/25 (40%)
TM helix 3 107..137 CDD:320438 10/29 (34%)
TM helix 4 149..172 CDD:320438 5/22 (23%)
TM helix 5 197..226 CDD:320438 9/29 (31%)
TM helix 6 245..275 CDD:320438 12/36 (33%)
TM helix 7 284..309 CDD:320438 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.