DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar14b

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076353.1 Gene:taar14b / 792119 ZFINID:ZDB-GENE-041210-316 Length:328 Species:Danio rerio


Alignment Length:293 Identity:78/293 - (26%)
Similarity:143/293 - (48%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLVFYMGS 114
            :|::|. |.:.:|.:.||:|.|::|...:.|.:. :|:.|||||.|||..|: .:|.||...:.|
Zfish    29 ILYVAA-AAVALLTVCGNLLVIISVSHFKQLHTP-ANILILSLAASDFLTGVFVIPLHLSLVIES 91

  Fly   115 DIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGA 179
            ...:....||:...:...|..||:.|:..|||||::|:.:...|...::..|..:..:.||....
Zfish    92 CWTSRSVMCLVFKVVNFQATSVSVHTVSLIAVDRFLALSFPFFYSEKISLTVVCTATLLNWLFSF 156

  Fly   180 LVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPG----------FVIIWICMFLVYWRIMREA 234
            :.....::.|.       .|.:|:.|. :...||.|          ||:..|.:.::|..:...|
Zfish   157 IYNFTLLYVNG-------NFTDVVCPA-VCFAITDGISSIIDLLIVFVMPCILIIILYTHVFVIA 213

  Fly   235 SKQALRLRQSVVYNTDEATTMRNLLL-HPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQS 298
            .|.|..:|...|:|:.|::  :|.:. ..:.|:..::..::..|.||.|||:..|:|..:: .::
Zfish   214 KKHATAIRALQVHNSTESS--KNKISDKSERKAAMLLGILVFVFLLCLLPYYITALAIPYN-SEN 275

  Fly   299 SSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            :..|..........||.:|||||:...|.|:::
Zfish   276 TLQIRDVAVIFFFLNSTINPIIYALFYSWFQKS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 75/283 (27%)
7tm_1 67..321 CDD:278431 70/265 (26%)
taar14bNP_001076353.1 7tm_1 44..298 CDD:278431 70/265 (26%)
7tm_4 44..>216 CDD:304433 48/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.