DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar7c

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001009975.1 Gene:Taar7c / 494535 RGDID:1359258 Length:358 Species:Rattus norvegicus


Alignment Length:352 Identity:86/352 - (24%)
Similarity:152/352 - (43%) Gaps:37/352 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFTSSSSPAWDYRS--SPEALGVVPFLWQHQNATETPTEITLQATSFGAGHLLWLAINAFLFVL 63
            ||....|.| ||..|  |.:.|........::|...:    .:::.......|:..|:..|..||
  Rat     1 MATDDDSFP-WDQDSILSRDLLSASSLQLCYENLNRS----CVRSPYSPGSRLILYAVFGFGAVL 60

  Fly    64 ILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FYMGSDIGAMRG 121
            .:.||:|.:.::...|.|.|. :|..:.|||.:|..||| .:|:.:|      :|.|:.......
  Rat    61 AVCGNLLVMTSILHFRQLHSP-ANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGNTYCKFHS 124

  Fly   122 PCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPV 186
             |....|     |..|:..|..|::||||||...|.|....|..::...|.|:|    |::::..
  Rat   125 -CFEGSF-----CYSSLFHLCFISLDRYIAVSDPLIYPTRFTASISGKCITFSW----LLSIIYS 179

  Fly   187 FWNRWPDAQACEFDEVLAPGYIAG----VITPGFVIIWICMFL--------VYWRIMREASKQAL 239
            |...:..|.....:::::.....|    .:...:|.|...:||        ||.:|...|.:||.
  Rat   180 FSLLYTGANEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAKQQAQ 244

  Fly   240 RLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYK 304
            .:.:........:.:.::.:...:.|:.:.:...:..|.|.|||||..:|...|....:.:.:|:
  Rat   245 NIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFITPTYMYE 309

  Fly   305 TTFSLAIANSALNPIIYSWKNSGFRRA 331
            ....:...|||:||:||::....||:|
  Rat   310 ILVWIVYYNSAMNPLIYAFFYPWFRKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 73/290 (25%)
7tm_1 67..321 CDD:278431 66/272 (24%)
Taar7cNP_001009975.1 7tm_4 54..>184 CDD:304433 41/140 (29%)
7tm_1 64..326 CDD:278431 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.