DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar7f

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001010839.1 Gene:Taar7f / 435207 MGIID:3527447 Length:358 Species:Mus musculus


Alignment Length:311 Identity:80/311 - (25%)
Similarity:137/311 - (44%) Gaps:28/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV----- 109
            |:..|:..|..||.:.||:|.:.::...|.|.|. :|..:.|||.:||.|| :.:|:.:|     
Mouse    48 LILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSP-ANFLVASLACADFLVGVMVMPFSMVRSVEG 111

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIF 173
             :|.|...      |.|.....:..|..|:..|..|:|||||||...|.|....|..|:...|.|
Mouse   112 CWYFGDSY------CKLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLAYPTRFTASVSGKCITF 170

  Fly   174 NWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAG---VITPGFVIIWICMFL--------VY 227
            :|.|........::...   ::|...|.|.:...:.|   .:...:|.|...:||        ||
Mouse   171 SWLLSISYGFSLIYTGA---SEAGLEDLVSSLTCVGGCQIAVNQTWVFINFSVFLIPTLVMITVY 232

  Fly   228 WRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQL 292
            .:|...|.:||..:.:........:.:.::.:...:.|:.:.:...:..|.|.|||||..:....
Mouse   233 SKIFLIAKQQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSFIDA 297

  Fly   293 FSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTLCCRTARQ 343
            |....:.:.:|:....:...|||:||:||::....||:|...|:..:..|:
Mouse   298 FLGFITPTYVYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLTVTGKILRE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 74/288 (26%)
7tm_1 67..321 CDD:278431 68/271 (25%)
Taar7fNP_001010839.1 7tm_4 54..>184 CDD:304433 42/136 (31%)
7tm_1 64..326 CDD:278431 68/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.