DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and mAChR-B

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster


Alignment Length:252 Identity:73/252 - (28%)
Similarity:116/252 - (46%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSPEALGVV--PF-LWQHQNATETPTEITLQATSFGAGHLLWLAI-NAFLFVLILGGNILTIVAV 75
            |..|.||.|  || |||                      .:.:|| .|...:|.:|||||.::|.
  Fly   116 SDSEILGPVLPPFALWQ----------------------TILIAICLAICIILTVGGNILVLLAF 158

  Fly    76 RTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLVFYMGS--DIGAMRGPCLLRFFLLICACCVS 137
            ...|::|.. ||.||.|||.:|..:| :::|::.::.:..  |:|.|.  |.|...:....|.||
  Fly   159 IVDRNIRQP-SNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPML--CDLWLSVDYTVCLVS 220

  Fly   138 MLTLISIAVDRYIAVVYALHYRRYMTR-RVAYSIIIFNWCLGALVALLPVF-WNRW-------PD 193
            ..|::.|.:|||.:|..|..||.:.|| ||.|.:.| .|.:.||:..:.:| |..:       |.
  Fly   221 QYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTI-TWIIPALLFFISIFGWEHFTGKRDLLPG 284

  Fly   194 AQACEF--DEVLAPGYIAGVITPGFVIIWICMFLVYWRI--MREASKQALRLRQSVV 246
            ..|.:|  |.:.....|.|......:::::....:|...  |::.|:...|..||:|
  Fly   285 QCAVQFLKDPIFNTALIIGYYWTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 60/202 (30%)
7tm_1 67..321 CDD:278431 58/196 (30%)
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 57/194 (29%)
7tm_4 150..>336 CDD:304433 54/189 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.