DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and CG13579

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster


Alignment Length:422 Identity:76/422 - (18%)
Similarity:137/422 - (32%) Gaps:168/422 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 INAFLFVL----ILGGNILTIVAVRTCRHLRSVIS--NLFILSLAVSDFCVGLAL---------- 104
            |.|.|.::    ::|.|.|.|..:...|:...:..  ...:.|||::|..:||.:          
  Fly    39 IEAVLILVLTLGVIGANCLVIFVINNRRYAAYIHQQPRYLLTSLALNDLTIGLLITPFGLMPALF 103

  Fly   105 ---PYHLVFYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRV 166
               ||..:|            |.::..|.......|.:.|:.:|||||:..::...|.::.:::.
  Fly   104 HCWPYGEIF------------CQIQALLRGALSQQSAVILVCMAVDRYMCALHPRRYYQHSSKKG 156

  Fly   167 AYSIIIFNWCL-----GALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPGFVIIWIC---- 222
            ..:|:...|.:     |.||.....::|. ....|||      |.|    ..|.:.|:..|    
  Fly   157 CVAILSLTWIISLTVFGFLVLPKGYYFNN-TGLMACE------PFY----SKPSYRILSTCALYF 210

  Fly   223 ---MFLVY----------WRI-----------------MREASKQALRLRQSVVYNTDEATTMRN 257
               |.|:|          :|:                 ....:.|.|::.|...::  :...|.:
  Fly   211 PTTMVLMYCYGSSFHMSRFRLNDPTMPLTAAAHHPHPHPHPTAAQQLQMHQHQQHH--QQAGMHS 273

  Fly   258 LLLH-------------------------------------------PDW--KSVQIVVFI---- 273
            .|.|                                           |:.  |..:.:|.|    
  Fly   274 HLYHGHSHHPSHPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPNMTNKITKKIVPIQEKN 338

  Fly   274 --------MGCFTLCWL----PYFCVAIAQLFSICQSSS----MIYKTTFSLAIANSALNPIIYS 322
                    |...:|.::    |:   .|.::.:.|..|.    :.:..|:: |::||..||.:|.
  Fly   339 SSGSTSRSMAAISLGFIVMVTPW---TIQEIVTACTGSKLPPFLDFLVTWT-ALSNSLWNPFMYW 399

  Fly   323 WKNSGFRRAFVQTL----------------CC 338
            ..||.|||...|.:                ||
  Fly   400 LLNSDFRRMSRQLMPNKCFPHEDTPEHKSGCC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 70/393 (18%)
7tm_1 67..321 CDD:278431 63/372 (17%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.