DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Dop2R

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001014758.2 Gene:Dop2R / 33007 FlyBaseID:FBgn0053517 Length:905 Species:Drosophila melanogaster


Alignment Length:560 Identity:104/560 - (18%)
Similarity:162/560 - (28%) Gaps:281/560 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NATETPTEITLQATSFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSV--ISNLFILSL 93
            |.|::..|:.:      ..|..|..|.....:|.|.||||.|::|  ||. ||:  ::|.||:||
  Fly   362 NLTDSCGELRV------VDHNYWALILILFPILTLFGNILVILSV--CRE-RSLQTVTNYFIVSL 417

  Fly    94 AVSDFCVG-LALPYHLVFYMGSDIGAMRGP-CLLRFFLLICACC--VSMLTLISIAVDRYIAVVY 154
            |::|..|. :.:|:.:.|.:.   ||...| .:..|::.:...|  .|:..|::|::||||||..
  Fly   418 AIADLLVAVVVMPFAVYFLVN---GAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQ 479

  Fly   155 ALHYRRYM-TRRVAYSIIIFNWCLGALVALLPVFW------NRWPDAQACEFDEVLAPGYIAGVI 212
            .:.|.::. :|||..:|::. |.:.|.:. .|:..      ||.||  .|.|       |.|..|
  Fly   480 PIKYAKHKNSRRVCLTILLV-WAISAAIG-SPIVLGLNNTPNREPD--VCAF-------YNADFI 533

  Fly   213 ----TPGFVIIWICMFLVYWRIMR----------------------------------------E 233
                ...|.|..|.|..:||.|.:                                        :
  Fly   534 LYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALD 598

  Fly   234 ASKQALRL--------------------------------------------------------- 241
            :|:.|.|:                                                         
  Fly   599 SSRHASRILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNSVVAQI 663

  Fly   242 --------------------------------------------------------------RQS 244
                                                                          |.|
  Fly   664 TTQPQLVVADPNGNHDSGYAASNVDDVLAGVAPASASAATSAAPRSSGSPPDSPLPSGATLQRSS 728

  Fly   245 VV-------------------------------------YNTDEATTM-RN-------------- 257
            |.                                     |...||.|: ||              
  Fly   729 VSSQRRPTGDDSPKRGEPALRSVGVDNSSVAMKPLSFVRYGVQEAMTLARNDSTLSTTSKTSSRK 793

  Fly   258 ------------LLLH-------------PDWKSVQIVVFIMGCFTLCWLPYFCVAI-----AQL 292
                        ..:|             .:.|:.:.:..::|.|..||||:|...|     |:.
  Fly   794 DKKNSQASRFTIYKVHKASKKKREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKF 858

  Fly   293 FSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAF 332
            ...|:.....|..|..|...||.:||:||:..|..||:||
  Fly   859 KKDCRPGLTAYMMTTWLGYINSFVNPVIYTIFNPEFRKAF 898

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 96/528 (18%)
7tm_1 67..321 CDD:278431 89/511 (17%)
Dop2RNP_001014758.2 7tmA_D2-like_dopamine_R 376..>565 CDD:320181 62/205 (30%)
TM helix 1 377..403 CDD:320181 11/27 (41%)
TM helix 2 410..436 CDD:320181 9/25 (36%)
TM helix 3 448..478 CDD:320181 10/29 (34%)
TM helix 4 490..513 CDD:320181 7/24 (29%)
TM helix 5 529..558 CDD:320181 9/28 (32%)
7tm_GPCRs <822..898 CDD:333717 23/75 (31%)
TM helix 6 825..850 CDD:320095 8/24 (33%)
TM helix 7 866..891 CDD:320095 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.