DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and HRH1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_000852.1 Gene:HRH1 / 3269 HGNCID:5182 Length:487 Species:Homo sapiens


Alignment Length:474 Identity:88/474 - (18%)
Similarity:157/474 - (33%) Gaps:183/474 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSFGAGHLLWLAINAFLFVLI-LGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPY 106
            |:..:..|:.|.:......|: :|.|:|.:.|||:.|.|.:| .||:|:||:|:|..|| :.:|.
Human    20 TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTV-GNLYIVSLSVADLIVGAVVMPM 83

  Fly   107 HLVFYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSII 171
            ::::.:.|.....|..||....:...|...|:.::..:.:|||.:|...|.|.:|.|:..|.:.|
Human    84 NILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATI 148

  Fly   172 IFNWCLGALVALLPVFWNRWPDAQA------CEFD-------EVLAPGYIAGVITPGFVIIWICM 223
            :..|.|..|..:..:.||.:....:      ||.|       :|:..  |.....|..:::|. .
Human   149 LGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTA--IINFYLPTLLMLWF-Y 210

  Fly   224 FLVY------------------------------------------WRIMREASKQA-------- 238
            ..:|                                          |.:::...|.|        
Human   211 AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKS 275

  Fly   239 -----LRLRQSVVYN-------------------------------------------------- 248
                 ..::..||::                                                  
Human   276 PSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNT 340

  Fly   249 --------------------TDEATT-----------------------------------MRNL 258
                                ||..||                                   :..|
Human   341 HGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGL 405

  Fly   259 LLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQS--SSMIYKTTFSLAIANSALNPIIY 321
            .::.:.|:.:.:.|||..|.|||:|||  ....:.:.|::  :..::..|..|...||.|||:||
Human   406 HMNRERKAAKQLGFIMAAFILCWIPYF--IFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIY 468

  Fly   322 SWKNSGFRRAFVQTLCCRT 340
            ...|..|::.|.:.|..|:
Human   469 PLCNENFKKTFKRILHIRS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 82/447 (18%)
7tm_1 67..321 CDD:278431 76/429 (18%)
HRH1NP_000852.1 7tmA_Histamine_H1R 28..479 CDD:320178 83/456 (18%)
TM helix 1 30..54 CDD:320178 7/23 (30%)
TM helix 2 63..85 CDD:320178 10/21 (48%)
TM helix 3 101..123 CDD:320178 3/21 (14%)
Important for agonist binding 107..112 1/4 (25%)
TM helix 4 146..162 CDD:320178 4/15 (27%)
TM helix 5 188..211 CDD:320178 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..291 5/52 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..379 4/33 (12%)
TM helix 6 414..436 CDD:320178 10/23 (43%)
Important for agonist binding 424..428 2/3 (67%)
TM helix 7 447..472 CDD:320178 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.