DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar9

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_783192.1 Gene:Taar9 / 319107 RGDID:631383 Length:338 Species:Rattus norvegicus


Alignment Length:296 Identity:74/296 - (25%)
Similarity:128/296 - (43%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FY 111
            |.:.|.|.|.   ||:|.|.|:...:.|.:. :|..:.|||.:||.||: .:|:..|      :|
  Rat    29 LGLGALLAVF---GNLLVITAILHFKQLHTP-TNFLVASLACADFLVGVTVMPFSTVRSVEGCWY 89

  Fly   112 MGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWC 176
            .| |.......|....|     |..|:..|..|::|||:||...|.|....|..|:...|..:|.
  Rat    90 FG-DTYCKFHTCFDTSF-----CFASLFHLCCISIDRYVAVTDPLTYPTKFTISVSGVCIALSWF 148

  Fly   177 LGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITP---GFVIIWICMF--------LVYWRI 230
            .....: ..:|:. ..:.:..| :.|:|...:.|...|   .:|::...:|        .:|.||
  Rat   149 FSVTYS-FSIFYT-GANEEGIE-ELVVALTCVGGCQAPLNQNWVLLCFLLFFLPTVVMVFLYGRI 210

  Fly   231 MREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSI 295
            ...|.:||.::..|.......:.:.:..:...:.|:.:.:...|..|.:.||||...|:...:..
  Rat   211 FLVAKQQARKIEGSANQPQASSESYKERVARRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMN 275

  Fly   296 CQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            ..:.:.:|:........|||:||:||::....||:|
  Rat   276 FITPAYVYEILVWCVYYNSAMNPLIYAFFYPWFRKA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 71/289 (25%)
7tm_1 67..321 CDD:278431 65/271 (24%)
Taar9NP_783192.1 7tm_4 34..>151 CDD:304433 38/126 (30%)
7tm_1 39..301 CDD:278431 65/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.