DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar8b

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_006227781.1 Gene:Taar8b / 319106 RGDID:631386 Length:359 Species:Rattus norvegicus


Alignment Length:332 Identity:85/332 - (25%)
Similarity:149/332 - (44%) Gaps:44/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TETPTEITLQ-----------ATSFGAG-HLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVI 85
            |...::.|||           .|.:..| .:|...:..|..||.:.||:|.:::|...:.|.|. 
  Rat    17 TSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFKQLHSP- 80

  Fly    86 SNLFILSLAVSDFCVGLA-LPYHLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLIS 143
            :|..|.|||.:||.||:: :|:.:|      :|.|....::...|...|      |..|:..|..
  Rat    81 ANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAF------CYSSLFHLCF 139

  Fly   144 IAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYI 208
            |:|||||||...|.|....|..|:...|..:|.| .||....||:.   ...|...:.:::....
  Rat   140 ISVDRYIAVTEPLVYPTKFTMSVSGICISISWIL-PLVYSSAVFYT---GISATGIENLVSALNC 200

  Fly   209 AG----VITPGFVII--------WICMFLVYWRIMREASKQALRLRQSVVYNTDEAT--TMRNLL 259
            .|    .|...:|:|        .:.|.::|.:|...|.:||:::..|:..:..|::  :.:..:
  Rat   201 VGGCQVAINQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGESSLESHKARV 265

  Fly   260 LHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWK 324
            ...:.|:.:.:...:..|.:.||||....:...|....:.:.:|:....:|..|||:||:||::.
  Rat   266 AKRERKAAKTLGVTVMAFMVSWLPYTIDTLIDAFMGFITPAYVYEICGWIAYYNSAMNPLIYAFF 330

  Fly   325 NSGFRRA 331
            ...||:|
  Rat   331 YPWFRKA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 77/292 (26%)
7tm_1 67..321 CDD:278431 70/274 (26%)
Taar8bXP_006227781.1 7tm_4 57..342 CDD:304433 77/292 (26%)
7tm_1 63..327 CDD:278431 70/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.