DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar8c

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_783190.1 Gene:Taar8c / 319105 RGDID:631390 Length:344 Species:Rattus norvegicus


Alignment Length:331 Identity:90/331 - (27%)
Similarity:151/331 - (45%) Gaps:42/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TETPTEITLQ-----------ATSFGAG-HLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVI 85
            |...::.|||           .|.:..| .:|...:..|..||.:.||:|.:::|...:.|.|. 
  Rat     2 TSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFKQLHSP- 65

  Fly    86 SNLFILSLAVSDFCVGLA-LPYHLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLIS 143
            :|..|.|||.:||.||:: :|:.:|      :|.|....::...|.:.|      |..|.|.|..
  Rat    66 ANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDVAF------CYSSALHLCF 124

  Fly   144 IAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYI 208
            |:|||||||...|.|....|..|:...|..:|.| .||....||:. ...|...| :.|.|...:
  Rat   125 ISVDRYIAVTDPLVYPTKFTVSVSGICISISWIL-PLVYSSAVFYT-GISAMGIE-NLVSALNCV 186

  Fly   209 AG---VITPGFVII--------WICMFLVYWRIMREASKQALRLRQSVVYNTDEAT--TMRNLLL 260
            .|   |:...:|:|        .:.|.::|.:|...|.:||:::..||..:..|::  :.:..:.
  Rat   187 GGCQVVVNQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGSKGESSLESHKARVA 251

  Fly   261 HPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKN 325
            ..:.|:.:.:...:..|.:.||||....:...|....:.:.:|:.....|..|||:||:||::..
  Rat   252 KRERKAAKTLGVTVLAFIVSWLPYTIDTLIDAFMGFITPAYVYEFCCWSAYYNSAMNPLIYAFFY 316

  Fly   326 SGFRRA 331
            ..||:|
  Rat   317 PWFRKA 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 82/291 (28%)
7tm_1 67..321 CDD:278431 75/273 (27%)
Taar8cNP_783190.1 7tm_4 42..297 CDD:304433 71/264 (27%)
7tm_1 48..312 CDD:278431 75/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.