DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar7d

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_783181.2 Gene:Taar7d / 294134 RGDID:631395 Length:358 Species:Rattus norvegicus


Alignment Length:299 Identity:81/299 - (27%)
Similarity:134/299 - (44%) Gaps:28/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV----- 109
            |:..|:..|..||.:.||:|.:.::...|.|.|. :|..:.|||.:|..||| .:|:.:|     
  Rat    48 LILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSP-ANFLVASLACADLLVGLTVMPFSMVRSVEG 111

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIF 173
             :|.|...      |.|.....:..|..|:..|..|:|||||||...|.|....|..|:...|.|
  Rat   112 CWYFGDTY------CKLHTSFDVSFCYCSLFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITF 170

  Fly   174 NWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITP---GFVIIWICMFL--------VY 227
            :|.|..:.....::...   ::|...|.|.|...:.|...|   .||:|...:||        ||
  Rat   171 SWLLSIIYGFPLIYTGA---SEAGLEDLVSALTCVGGCQIPMNQKFVLINFLLFLVPTLVMMTVY 232

  Fly   228 WRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQL 292
            .:|...|.:||..:.:........:.:.::.:...:.|:.:.:...:..|.|.|||||..:|...
  Rat   233 SKIFLIARQQAQNIEKMRKQTARASESYKDRVCKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDA 297

  Fly   293 FSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            |....:.:.:|:....:...||::||:||::....||:|
  Rat   298 FLGFITPTYVYEILIWIVYYNSSMNPLIYAFFYPWFRKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 78/289 (27%)
7tm_1 67..321 CDD:278431 71/271 (26%)
Taar7dNP_783181.2 7tm_4 54..>184 CDD:304433 42/136 (31%)
7tm_1 64..326 CDD:278431 71/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.