DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar5

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001009650.1 Gene:Taar5 / 294123 RGDID:1359185 Length:337 Species:Rattus norvegicus


Alignment Length:318 Identity:74/318 - (23%)
Similarity:126/318 - (39%) Gaps:75/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV----- 109
            |::||....:.:.:| ||:..:.||...:.|.:. :|..:||||::|..:| |.||...|     
  Rat    36 LIYLACAVGMLITVL-GNLFVVFAVSYFKVLHTP-TNFLLLSLALADMLLGLLVLPLSTVRSVES 98

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIF 173
             ::.|..:      |.|..:|....|..|:..|..|::||:.|:...|.|....|.|:|...|..
  Rat    99 CWFFGDFL------CRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRIALRYIAA 157

  Fly   174 NW----------------------------CLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAG 210
            .|                            |:|:...|...||. |                   
  Rat   158 GWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWG-W------------------- 202

  Fly   211 VITPGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNL--LLHPDWKSVQIVVFI 273
            :..|.|.|..:.|..:|.:|...|::||.::|          |..::|  .:..:.|:.:.:...
  Rat   203 LNFPAFFIPCLIMISLYLKIFVVATRQAQQIR----------TLSQSLSGAVKRERKAAKTLGIA 257

  Fly   274 MGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            :|.:.:||||:....:........:..:::......|..|||.|||||.:....||:|
  Rat   258 VGIYLVCWLPFTVDTLVDSLLNFVTPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 71/308 (23%)
7tm_1 67..321 CDD:278431 65/290 (22%)
Taar5NP_001009650.1 7tm_1 51..305 CDD:278431 65/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.