DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar2

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001008512.1 Gene:Taar2 / 294121 RGDID:1311240 Length:339 Species:Rattus norvegicus


Alignment Length:324 Identity:82/324 - (25%)
Similarity:142/324 - (43%) Gaps:52/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TLQATSFGAG----HLLWLAINAFLFVLILG-------GNILTIVAVRTCRHLRSVISNLFILSL 93
            |...:.:|.|    :...|.:.|.::.|:.|       ||::.|:::...:.|.:. :||.|||:
  Rat    10 TFDCSEYGNGSCPENERSLGVRAAMYSLMAGAIFITIFGNLVMIISISYFKQLHTP-TNLLILSM 73

  Fly    94 AVSDFCVGLA-LPYHLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIA 151
            ||:||.:|.. :||.:|      :|.|...      |.:.:...:.....|:..|.|:|:||:.|
  Rat    74 AVTDFLLGFTIMPYSMVRSVENCWYFGLTF------CKIHYSFDLMLSITSIFHLCSVAIDRFYA 132

  Fly   152 VVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPDA-------QACE------FDEVL 203
            :.:.|||...||..|...:::..|.:....|...||...:.|.       .||.      |:::.
  Rat   133 ICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLW 197

  Fly   204 APG-YIAGVITPGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSV 267
            ... ::||..||..:::.|     |.:|...:.|.|     .|:.|..|   .:|..:..|.|:.
  Rat   198 GTTLFVAGFFTPSSMMVGI-----YGKIFAVSKKHA-----RVIDNLPE---NQNNQMRKDKKAA 249

  Fly   268 QIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            :.:..:||.|.|||.|.|...:...|....:.::::.........||..||:||.:....||||
  Rat   250 KTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAILFDALTWFGYFNSTCNPLIYGFFYPWFRRA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 77/299 (26%)
7tm_1 67..321 CDD:278431 69/274 (25%)
Taar2NP_001008512.1 7tm_4 42..315 CDD:304433 75/292 (26%)
7tm_1 48..303 CDD:278431 69/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.