DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Adrb1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_036833.1 Gene:Adrb1 / 24925 RGDID:2059 Length:466 Species:Rattus norvegicus


Alignment Length:394 Identity:112/394 - (28%)
Similarity:173/394 - (43%) Gaps:76/394 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSSPAWD---------YRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAGHLLWLAINAFL 60
            ||::|..|         ..:||.|..:.|       |:|....::.|.|: |.|.||     |.:
  Rat    17 SSAAPLPDGAATAARLLVLASPPASLLPP-------ASEGSAPLSQQWTA-GMGLLL-----ALI 68

  Fly    61 FVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALPYHLVFYMGSDI---GAMR-G 121
            .:||:.||:|.|||:.....|:: ::||||:|||.:|..:||     ||...|:.|   |... |
  Rat    69 VLLIVVGNVLVIVAIAKTPRLQT-LTNLFIMSLASADLVMGL-----LVVPFGATIVVWGRWEYG 127

  Fly   122 PCLLRFFLLICACCV--SMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALL 184
            ......:..:...||  |:.||..||:|||:|:.....|:..:||..|.:::...|.:.|||:.|
  Rat   128 SFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVCTVWAISALVSFL 192

  Fly   185 PVFWNRW-----------PDAQACEFDEVLAPGYIAGVITPGFVIIWICMFLVYWRIMREASKQA 238
            |:..:.|           .|.:.|:|....|....:.|::  |.:....|..||.|:.|||.||.
  Rat   193 PILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVS--FYVPLCIMAFVYLRVFREAQKQV 255

  Fly   239 LRL----------------------------RQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMG 275
            .::                            ..|:............|:...:.|:::.:..|||
  Rat   256 KKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMG 320

  Fly   276 CFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTLCCRT 340
            .|||||||:|...:.:.|........::.....|..||||.|||||. ::..||:||.:.|||..
  Rat   321 VFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYC-RSPDFRKAFQRLLCCAR 384

  Fly   341 ARQC 344
            ...|
  Rat   385 RAAC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 89/315 (28%)
7tm_1 67..321 CDD:278431 83/298 (28%)
Adrb1NP_036833.1 7tm_1 75..366 CDD:278431 83/298 (28%)
7tm_4 76..>267 CDD:304433 59/198 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..302 1/37 (3%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..466
PDZ-Binding. /evidence=ECO:0000250 463..466
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.