DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar6

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001010828.1 Gene:Taar6 / 215855 MGIID:2685074 Length:345 Species:Mus musculus


Alignment Length:344 Identity:86/344 - (25%)
Similarity:148/344 - (43%) Gaps:42/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAG-HLLWLAINAFLFVLILGGN 68
            |:|||       |..|.:.     ::|.|.:..:     |.:..| .::..|:..|..||.:.||
Mouse     3 SNSSP-------PTVLQLC-----YENVTGSCVK-----TPYSPGSRVILYAVFGFGAVLAVFGN 50

  Fly    69 ILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLA-LPYHLV------FYMGSDIGAMRGPCLLR 126
            ::.::::...:.|.|. :|..|.|||.:||.||:: :|:.:|      :|.|.........|.:.
Mouse    51 LMVMISILHFKQLHSP-TNFLIASLACADFGVGISVMPFSMVRSIESCWYFGRSFCTFHTCCDVA 114

  Fly   127 FFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRW 191
            |      |..|:..|..|::||||||...|.|....|..|:...|..:|.| .||....||:...
Mouse   115 F------CYSSLFHLSFISIDRYIAVTDPLVYPTKFTVSVSGICIGVSWIL-PLVYSGAVFYTGV 172

  Fly   192 PDAQACEFDEVL-APGYIAGVITPGFVII--------WICMFLVYWRIMREASKQALRLRQSVVY 247
            .|....|....| ..|....|:...:|:|        .:.|.::|..|...|.:||.::......
Mouse   173 YDDGLEELSSALNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIENIGSK 237

  Fly   248 NTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIA 312
            ....:.:.:..:...:.|:.:.:...:..|.:.||||...::...|....:.:.||:.....|..
Mouse   238 TESSSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCAYY 302

  Fly   313 NSALNPIIYSWKNSGFRRA 331
            |||:||:||:.....|::|
Mouse   303 NSAMNPLIYALFYPWFKKA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 74/287 (26%)
7tm_1 67..321 CDD:278431 68/269 (25%)
Taar6NP_001010828.1 7tm_4 43..>271 CDD:304433 57/235 (24%)
7tm_1 49..311 CDD:278431 68/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.