DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar7b

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001010827.1 Gene:Taar7b / 209517 MGIID:3527438 Length:358 Species:Mus musculus


Alignment Length:358 Identity:90/358 - (25%)
Similarity:151/358 - (42%) Gaps:49/358 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFTSSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQ-------ATSFGAG-HLLWLAIN 57
            ||..:.|.| ||..|          :......:.|.||:..:       .:.:..| .|:..|:.
Mouse     1 MATDNDSFP-WDQDS----------ILSSDMFSATSTELCYENLNRSCVRSPYSPGPRLILYAVF 54

  Fly    58 AFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FYMGSD 115
            .|...|.:.||:|.:.::...|.|.|. :|..::|||.:||.||| .:|:..|      :|.|..
Mouse    55 GFGAALAVCGNLLVMTSILHFRQLHSP-ANFLVVSLACADFLVGLTVMPFSTVRSVEGCWYFGES 118

  Fly   116 IGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGAL 180
            .      |.|.....:..|..|:..|..|:|||||||...|.|....|..|:...|.|:|.|..:
Mouse   119 Y------CKLHTCFDVSFCYCSIFHLCFISVDRYIAVSDPLTYPTRFTAFVSGKCITFSWLLSTI 177

  Fly   181 VALLPVFWNRWPDAQACEFDEVLAPGYIAG----VITPGFVIIWICMFL--------VYWRIMRE 233
            ..    |...:..|.....:::::.....|    .:...:|.|...:||        ||.:|...
Mouse   178 YG----FSLLYTGANEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLIPTLVMITVYSKIFLI 238

  Fly   234 ASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQS 298
            |.:||..:.:........:.:.::.:...:.|:.:.:...:..|.|.|||||..:|...|....:
Mouse   239 AKQQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFIT 303

  Fly   299 SSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            .:.:|:....:|..|||:||:||::....||:|
Mouse   304 PTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 76/290 (26%)
7tm_1 67..321 CDD:278431 70/272 (26%)
Taar7bNP_001010827.1 7tm_4 54..>184 CDD:304433 43/140 (31%)
7tm_1 64..326 CDD:278431 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.